6L7QA

Crystal structure of a hypothetical protein pych_01220 derived from pyrococcus yayanosii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
MMLLTRHAKERIAKRLAKKRSLSHIYSSLWAFLERAVRIEIAEGVVAFTDGRKTLVCVPLDCERLSRGEILEKVRGVGVYECIFPEGRLAKLTRPEKFLESVPPGEYYFYMNDEKKVLYVGKRRPLLAITFRPAKRDERLFYIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein
publication title Crystal structure of PYCH_01220 from Pyrococcus yayanosii potentially involved in binding nucleic acid.
pubmed doi rcsb
source organism Pyrococcus yayanosii (strain ch1 / jcm 16557)
total genus 44
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2019-11-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...