6LE3E

Crystal structure of gluconate 5-dehydrogenase from lentibacter algarum
Total Genus 90

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
247
Chain Sequence
HLFDLSGKVACITGASSGLGRRAALTLAAAGAKVVGVARRADALDNLCAEIGPAAAAVVADVASRDGLERTVADISAPFGAPDILVHAAGVNTREAADDVTFNGWDQTLALNLSAPFFLSKAFVPEMRKKGWGRIVNFASLQTTRAFPGGIAYGATKGGIAQLTRAMAEAWSPDGITANAIGPGFPTELTAAVFEDDARAARNAAQTCIGRNGTLSDMDGPILFLCSDASAYVTGQVLMVDGGFTAK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (23-35)TI1 (6-9)TI5 (82-85)TII1 (10-13)S4 (89-92)EMPTYS1 (14-18)TI2 (19-22)TIV2 (56-59)S2 (38-43)S3 (60-64)TI4 (66-69)AH3 (73-82)AH4 (107-135)TVIII1 (87-90)AH8 (225-232)S5 (138-143)S6 (181-188)3H3 (146-148)TI'1 (247-250)TII2 (152-155)3H6 (234-236)AH5 (155-176)TI8 (236-239)AH6 (196-201)TI6 (193-196)TI7 (213-216)S7 (242-246)TIV1 (17-20)AH2 (46-56)3H1 (70-72)3H2 (102-104)3H4 (177-179)TIV3 (239-242)AH7 (203-212)3H5 (221-224)Updating...
connected with : NaN
molecule tags Biosynthetic protein
source organism Lentibacter algarum
publication title Crystal structure of gluconate 5-dehydrogenase from Lentibacter algarum.
pubmed doi rcsb
molecule keywords Gluconate 5-dehydrogenase
total genus 90
structure length 247
sequence length 248
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2019-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.