The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
90
|
sequence length |
279
|
structure length |
279
|
Chain Sequence |
SIKIKNAVEIEKMRVAGRLAAEVLEMIEPHVKAGVTTEELDQICHKYITEVQGAIPAPLNYHGFPKSICTSINHIVCHGIPASEDTYFGQIQRPAVLRDGDILNIDITVIKDGYHGDTSKMFLIGDVSIEDKRLCHVAQECLYLALKQVKPGVQLGEIGTTIEKHIKTNNKNNPRFKFSIVRDYCGHGIGAEFHEEPQVVHYKNSDRTVLREGMIFTIEPMINAGKFGCRLDDEDSWTVYTADGKKSAQWEHTILVTATGCEILTLRSEESLPRILNNA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Methionine aminopeptidases with short sequence inserts within the catalytic domain are differentially inhibited: Structural and biochemical studies of three proteins from Vibrio spp.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
|
molecule keywords |
Methionine aminopeptidase
|
total genus |
90
|
structure length |
279
|
sequence length |
279
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.4.11.18: Methionyl aminopeptidase. |
pdb deposition date | 2019-12-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00557 | Peptidase_M24 | Metallopeptidase family M24 |
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...