6LHYA

Crystal structure of thsb
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
177
Chain Sequence
KRVFFSFHYQDVIDFRVNVVRNHWVTKLNQSAAGVFIALKRLINGGLNNTSVTCVLIGSQTFNRRWVRYEIMKSIEKGNKIIGIHINAFKDKYGNIKSKGPNPFDYLGYQYSSDGKQLHLYEWTGGKWEEYKDLAPYRVNQIAPESLRGKFYSLSSVYRVYDWVADDGYNKFSSWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords DUF1863 domain-containing protein
publication title Structural and functional evidence of bacterial antiphage protection by Thoeris defense system via NAD+degradation.
pubmed doi rcsb
source organism Bacillus cereus msx-d12
total genus 52
structure length 177
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08937 DUF1863 MTH538 TIR-like domain (DUF1863)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...