6M36A

The crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
139
structure length
103
Chain Sequence
DYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAGEVSIRFGVFEDRLEVIVADGLGLYLMETLMDEVRVQNHGVTVAMTKYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the regulation of SigB activity by RsbV and RsbW.
doi rcsb
molecule tags Signaling protein
source organism Bacillus subtilis (strain 168)
molecule keywords Serine-protein kinase RsbW
total genus 29
structure length 103
sequence length 139
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2020-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13581 HATPase_c_2 Histidine kinase-like ATPase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...