6M6MA

The crystal structure of glycosidase mutant
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
447
structure length
447
Chain Sequence
FMVELSPLRQDFVWGTATSAYQIEGAVADDGRLPSIWDTFCRVPGAIDNGDTGDVACDSYHRWPEDLALLKQLGVDAYRFSIAWPRVIPTGSGAVNTAGLDYYDRVVDDLLAEGIKPFVTLYHWDLPQALQDLGGWDNRDTAYRFAEYAAVVGAKLGDRVRDWVTLNEPLCSAWIGHWEGRMAPGITDPAIAVRASYNLLLAHGLGVAALRDACPEPPAVGLVVNLSGCEPASQSPEDIRAARIADGHFNRWWLDPTSGRGFPADMVETYGVELPERPGDLEIIAAPTDFIGLNYYFRQIIEADGSVPVLGFSQVPGPNAEHTMIDWEVHPAGLEELILRLAKEYGAEKIYVTENGSAWVDQPDAEFAVDDPDRTAYLEEHLAACVRAVEQGAPLAGYFAWSLMDNFEWARGYAPRFGLAYVDYPTGTRVMKTSGKRYADLIRGHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Structural Elucidation of Enhanced Catalytic Activity upon Engineering Glycosidase KfGH01 for the Production of Vina-ginsenoside R7
rcsb
molecule tags Hydrolase
source organism Kribbella flavida (strain dsm 17836 / jcm 10339 / nbrc 14399)
molecule keywords Beta-glucosidase
total genus 178
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2020-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...