6MB7A

Binary (paromomycin) structure of aac-iiib
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
265
structure length
265
Chain Sequence
SFATRTSLAADLAALGLAWGDAIMVHAAVSRVGRLLDGPDTIIAALRDTVGPGGTVLAYADWEARYEDLVDDAGRVPPEWREHVPPFDPQRSRAIRDNGVLPEFLRTTPGTLRSGNPGASLVALGAKAEWFTADHPLDYGYGEGSPLAKLVEAGGKVLMLGAPLDTLTLLHHAEHLADIPGKRIKRIEVPFATPTGTQWRMIEEFDTGDPIVAGLAEDYFAGIVTEFLASGQGRQGLIGAAPSVLVDAAAITAFGVTWLEKRFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Aac(3)-IIIb protein
publication title Encoding of Promiscuity in an Aminoglycoside Acetyltransferase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 76
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2018-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02522 Antibiotic_NAT Aminoglycoside 3-N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...