6MI6A

Structure of chea domain p4 in complex with an adp analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
183
Chain Sequence
IRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide spin-labeling for ESR spectroscopy of ATP-binding proteins
doi rcsb
molecule keywords Chemotaxis protein CheA
molecule tags Signaling protein
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 42
structure length 183
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2018-09-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...