6MI7F

Nucleotide-free cryo-em structure of e.coli lptb2fgc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
352
structure length
217
Chain Sequence
IIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWAGPWSSRHQDEVLARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSLKSNDPTLWMWTVNLIYLALAIVLNLWDTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of lipopolysaccharide extraction by the LptB2FGC complex.
pubmed doi rcsb
molecule keywords Lipopolysaccharide export system permease protein LptF
molecule tags Hydrolase/transport protein
source organism Escherichia coli (strain k12)
total genus 44
structure length 217
sequence length 352
ec nomenclature
pdb deposition date 2018-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03739 LptF_LptG Lipopolysaccharide export system permease LptF/LptG
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...