6MR1A

Rbcs-like subdomain of ccmm
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
NTMTTDYGTHVRQLLQQGYQISLEYADARRYRTSSWQSGPTLTGQQESQVMAAIAQLLKEHEGEYVRLIGVDPKAKRRVFEEIIQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The small RbcS-like domains of the beta-carboxysome structural protein CcmM bind RubisCO at a site distinct from that binding the RbcS subunit.
pubmed doi rcsb
molecule tags Protein binding
source organism Thermosynechococcus elongatus (strain bp-1)
molecule keywords Carbon dioxide concentrating mechanism protein
total genus 24
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-10-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...