6MU8D

Crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-386150 in complex with human antibodies 3h109l and 35o22 at 3.5 angstrom
Total Genus 18

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
QGQLVQSGATTTKPGSSVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVNMTTDTEVPVTSFTSTGAAYMEIRNLTSDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (3-6)S9 (102-103)EMPTYS2 (19-27)TII1 (13-16)S8 (88-94)TI6 (84-87)TI1 (28-31)TI5 (83-86)S3 (34-40)3H1 (61-63)S4 (46-51)S5 (57-59)TIV1 (52-54)TIV2 (52-55)S6 (67-72)TIV6 (100-100)S10 (107-108)TIV3 (63-66)Updating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Human immunodeficiency virus 1
publication title Lattice engineering enables definition of molecular features allowing for potent small-molecule inhibition of HIV-1 entry.
pubmed doi rcsb
molecule keywords Envelope glycoprotein gp160
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2018-10-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.