6MU9A

Beta-lactamase penicillinase from bacillus megaterium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
TKSDREFAKLEDKYDANLGVFALDTGTNKTVTYHPDERFAYASTHKALAVGALLQQKSIEDLNERIFYTRDDLVNYNPITEKHVDTGMTLRELADASLRYSDNTAGNLILQQLDGPDGFKEALEKIGDNVTLPERFEPDLNEVNPGETHDTSTPRALAASLQKYVLGQALPEDKRALLTDWMKRNTTGDALIRAGVPKSWEVADKTGAGSYATRNDIAILWPPNGDPIVLAILSNRTEKDAEYNDKLIAEAAKQAVKTLKITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-lactamase penicillinase from Bacillus megaterium
rcsb
molecule tags Ligase
source organism Bacillus megaterium
molecule keywords Beta-lactamase
total genus 98
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2018-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...