6MXEA

Crystal structure of human sting (g230a, h232r, r293q) in complex with compound 18
Total Genus 53

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
164
Chain Sequence
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCRLIAYQESFSLSQEVLRHLRQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (155-166)EMPTYUpdating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Homo sapiens
publication title Discovery of a Novel cGAMP Competitive Ligand of the Inactive Form of STING.
pubmed doi rcsb
molecule keywords Stimulator of interferon genes protein
total genus 53
structure length 164
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.