6MYDA

Structure of zebrafish traf6 in complex with sting ctt
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
SAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEVTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modular Architecture of the STING C-Terminal Tail Allows Interferon and NF-kappa B Signaling Adaptation.
pubmed doi rcsb
molecule tags Immune system
source organism Danio rerio
molecule keywords TNF receptor-associated factor 6
total genus 37
structure length 155
sequence length 155
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2018-11-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...