6MYLA

The prp8 intein-cisplatin complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
170
structure length
140
Chain Sequence
CLQNGTRLLRADGSEILVEDVQEGDQLLGPDGTSRTASKIVRGEERLYRIKADELEDLVCTHNHILSLYKERSYERVDITVDDFVRLPQQEQQKYRLFRSTATLLHIMSIDLEEKPTKWSGFVVDKDSLYLRHDYLVLHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cisplatin inhibits Prp8 intein splicing and protects mice from challenge of Cryptococcus neoformans
rcsb
molecule tags Hydrolase/hydrolase inhibitor
source organism Cryptococcus gattii serotype b
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 36
structure length 140
sequence length 170
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2018-11-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...