6MZ3A

Mcherry ph sensitive mutant - m66t (mcherrytyg)
Total Genus 63

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
220
structure length
219
Chain Sequence
NMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S2 (25-36)TI1 (4-7)TVIII1 (6-9)EMPTYS5 (104-114)TVIII2 (9-12)S1 (12-22)TIV1 (21-24)S3 (41-50)TI4 (37-40)TI6 (76-79)S12 (210-221)TI3 (36-39)3H2 (62-64)TVIII4 (208-211)S11 (193-204)TI12 (205-208)3H1 (58-60)TVIa1 (86-89)S7 (140-143)TI5 (69-72)TIV3 (70-73)S10 (172-183)AH1 (82-86)TI7 (99-102)TIV4 (87-90)S4 (91-99)S9 (156-167)S6 (117-127)TIV5 (113-116)TI10 (135-138)TIV7 (152-155)S8 (146-153)TVIII3 (183-186)TIV2 (51-54)TIV6 (133-136)TI9 (134-137)TI11 (167-170)TI8 (130-133)Updating...
connected with : NaN
molecule tags Luminescent protein
source organism Discosoma sp.
publication title mCherry pH sensitive mutant - M66T (mCherryTYG)
rcsb
molecule keywords PAmCherry1 protein
total genus 63
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2018-11-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.