6MZBC

Cryo-em structure of phosphodiesterase 6
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
86
structure length
48
Chain Sequence
NLEPPKAEIRSATRVMGGPVTPRKGPPKFPWEAFNHLELHELAQYGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
pubmed doi rcsb
molecule keywords Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit bet
molecule tags Signaling protein
source organism Bos taurus
total genus 1
structure length 48
sequence length 86
chains with identical sequence D
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2018-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04868 PDE6_gamma Retinal cGMP phosphodiesterase, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...