6MZNA

Zebrafish betaglycan orphan domain structure from tetragonal crystal form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
330
structure length
309
Chain Sequence
PCELLPVGVGHPVQAMLKSFTALSGCASRGTTSHPQEVHIINLRKTAEVALHLRPIQSLHVHQKPLVFILNSPQPILWKVRTEKLAPGVKRIFHVVEGSEVHFVKVETLPHGNEHLLNWAHHRYVTSFSELRMAHDIYIKVGEDPVFSETCKIDNKFLSLNYLASYIEPQPSTGCVLSGPDHEQEVHIIELQAPNSSSAFQVDVIVDLRPLDGDIPLHRDVVLLLKCEKSVNWVIKAHKVMGKLEIMTSDTVSLSEDTERLMQVSKTVKQKLPAGSQALIQWAEENGFNPVTSYTNTPVANHFNLRLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Adaptation in Its Orphan Domain Engenders Betaglycan with an Alternate Mode of Growth Factor Binding Relative to Endoglin.
pubmed doi rcsb
molecule tags Protein binding
source organism Danio rerio
molecule keywords Transforming growth factor beta receptor III
total genus 86
structure length 309
sequence length 330
ec nomenclature
pdb deposition date 2018-11-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...