6N8Nk

Cryo-em structure of lsg1-engaged (le) pre-60s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
121
structure length
121
Chain Sequence
KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-
publication title Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
pubmed doi rcsb
total genus 16
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2018-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF00276 Ribosomal_L23 Ribosomal protein L23
k PF03939 Ribosomal_L23eN Ribosomal protein L23, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...