6NCTB

Structure of p110alpha/nish2 - vector data collection
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
225
Chain Sequence
QDAEWYWGDISREEVNEKLRDTATFLVRDTKMHTLTLKLIKIFHRFSTFVVELINHYRNESLAQYNPKLDYPVSKYQQDEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQNEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Getting the most out of your crystals: Data collection at the new high-flux, microfocus MX beamlines at NSLS-II
doi rcsb
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
molecule tags Transferase
source organism Homo sapiens
total genus 66
structure length 225
sequence length 269
ec nomenclature
pdb deposition date 2018-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
B PF16454 PI3K_P85_iSH2 Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...