6NHUA

Crystal structure of the beta lactamase class d ybxi from agrobacterium fabrum
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
QAFECTLVTSIETGAIINQQGACDQRVAPASTFKVPLALIGFDAGILQDGKTPAWDWKPGTEARASDRKTVDPTIWEQDSVLWYSREITRRLGPEKFAAYVKRLGYGNADVSGEPGKNNGLTHSWLGASLTISPVEQVGFLRRLLGGNLPFSRDAQAKTRAIMPVFDAPESWAVHGKTGTGYMRDEKGNPDRNRPFGWFVGWAEREGQHIVFARLRVSDKPSNEPLGPAVRDAFLRDIPRLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Beta Lactamase Class D YbxI from Agrobacterium fabrum
rcsb
molecule tags Hydrolase
source organism Agrobacterium fabrum (strain c58 / atcc 33970)
molecule keywords Beta-lactamase
total genus 68
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2018-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...