6NK8A

C-terminal region of the burkholderia pseudomallei old protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
204
structure length
198
Chain Sequence
FFARGIIFVEGDAERFLIPAFAEALDIHLDILGISVCSVSGTNFAPYIKLVGPTGLNIPHVVLTDLDPVDDRPPLARKRLLRLLELAVTDEEDEPWDLGEEYGYFVNDSTLEPELFQAGLGSGIRDVIESELSTSAQTREALACWVDDPTALNNERLLKLIERIGKGRFAQALAGFATADTCPAYIRNALEYIRDAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Class 2 OLD family nuclease
publication title Structural characterization of Class 2 OLD family nucleases supports a two-metal catalysis mechanism for cleavage.
pubmed doi rcsb
source organism Burkholderia pseudomallei (strain 668)
total genus 62
structure length 198
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-01-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...