6NM7A

Pd-l1 igv domain bound to fragment
Total Genus 31

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKTQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHH

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTVIII1 (23-26)TII2 (81-84)TI4 (79-82)S7 (98-104)TII1 (31-34)S2 (34-38)O1 (96-98)S3 (54-59)3H1 (50-52)AH1 (89-94)S4 (62-68)TIV3 (67-70)S5 (71-72)TI3 (78-81)S6 (85-88)S8 (110-117)3H2 (106-108)TIV6 (117-120)S9 (121-131)TIV1 (44-47)TIV2 (58-61)TI1 (73-76)Updating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Homo sapiens
publication title Fragment-based screening of programmed death ligand 1 (PD-L1).
pubmed doi rcsb
molecule keywords Programmed cell death 1 ligand 1
total genus 31
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.