6NM8A

Igv-v76t bms compound 105
Total Genus 29

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKTQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHH

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H2 (79-81)TVIII1 (23-26)EMPTYTII1 (31-34)S7 (96-101)S2 (36-41)3H1 (50-52)S3 (53-59)S5 (71-73)TIV1 (58-61)S4 (62-68)S6 (85-88)3H3 (89-94)TII2 (81-84)TIV3 (67-70)TI1 (74-77)S8 (110-118)3H4 (106-108)TIV6 (117-120)S9 (121-131)TIV5 (101-104)Updating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Homo sapiens
publication title Fragment-based screening of programmed death ligand 1 (PD-L1).
pubmed doi rcsb
molecule keywords Programmed cell death 1 ligand 1
total genus 29
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.