6NQDC

Cryo-em structure of t/f100 sosip.664 hiv-1 env trimer in complex with 8anc195 fab
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
130
structure length
130
Chain Sequence
QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAVNWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLISAVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTYDRWSGLHHDGVMAFSSWGQGTLISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords T/F100 Env gp120
publication title A sequestered fusion peptide in the structure of an HIV-1 transmitted founder envelope trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 14
structure length 130
sequence length 130
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2019-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...