6O7EB

Cryo-em structure of csm-crrna-target rna ternary complex in complex with amppnp in type iii-a crispr-cas system
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
159
Chain Sequence
VDASRLFGESPDVVGIKKMGKQWEAIQPYFDNVVREAKNFLEWSPNKRLANAVTVAAYLTSQGLKTNQVRKILDMARTTELKVKRGEGDIKDDLVKMRYLLAYTVGKATGQSKYSLDAFHRILDPMLEVLMGSPKKENFEKFYDFLQAVVAYHKFFGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
pubmed doi rcsb
molecule keywords Csm1
molecule tags Immune system/rna
source organism Thermococcus onnurineus (strain na1)
total genus 40
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2019-03-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...