6OEMB

Cryo-em structure of mouse rag1/2 prc complex (dna0)
Total Genus 38
501001502002503000510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
351
structure length
346
Chain Sequence
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSYKGKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRSYMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRCS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (2-5)TIV5 (50-53)TIV1 (9-12)TI2 (12-15)TII1 (16-19)S2 (20-24)TIV8 (81-89)S12 (107-116)S3 (27-31)S4 (46-47)TIV3 (38-41)TIV4 (41-44)S7 (58-59)S5 (50-51)S6 (54-55)TI3 (63-66)TIV9 (115-118)S13 (119-122)S11 (102-103)S9 (90-95)S10 (97-98)S20 (181-186)S14 (125-127)S15 (130-131)TIV10 (130-133)S17 (150-156)TI7 (171-174)TIV11 (146-149)S16 (141-147)O1 (179-181)TI9 (197-200)TI6 (168-171)TI5 (164-167)TIV12 (163-166)TIV13 (169-172)S23 (215-219)S19 (175-177)TIV14 (187-190)TI8 (186-189)S22 (208-211)TI10 (223-226)S28 (288-292)S24 (233-239)TIV16 (241-244)S32 (343-349)TIV17 (258-261)S26 (262-267)TIV18 (267-270)AH1 (309-313)S27 (270-274)TIV19 (279-282)S29 (297-301)TIV21 (322-325)S30 (318-321)S31 (326-332)3H1 (335-337)TIV20 (293-296)S8 (75-80)TIV15 (212-215)Updating...
connected with : NaN
molecule tags Recombination/dna
source organism Mus musculus
publication title Cutting antiparallel DNA strands in a single active site
rcsb
molecule keywords V(D)J recombination-activating protein 1
total genus 38
structure length 346
sequence length 351
chains with identical sequence D
ec nomenclature
pdb deposition date 2019-03-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.