6OERH

Cryo-em structure of mouse rag1/2 nfc complex (dna2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
38
structure length
36
Chain Sequence
PSAFFLFCSEYRPKIKGEHPGIGDVAKKLGEMWNNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Recombination/dna
molecule keywords V(D)J recombination-activating protein 1
publication title Cutting antiparallel DNA strands in a single active site
rcsb
source organism Mus musculus
total genus 6
structure length 36
sequence length 38
ec nomenclature
pdb deposition date 2019-03-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...