6P20A

Bacteriophage phikz gp163.1 paar repeat protein in complex with a t4 gp5 beta-helix fragment modified to mimic the phikz central spike gp164
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
110
structure length
110
Chain Sequence
GSGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSKSSGTHIQEAGGTMTHKAGGNMLFTAPRYDFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with a T4 gp5 beta-helix fragment modified to mimic the phiKZ central spike gp164
rcsb
molecule tags Viral protein
source organism Enterobacteria phage t4
molecule keywords Baseplate central spike complex protein gp5,PHIKZ164
total genus 1
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2019-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06715 Gp5_C Gp5 C-terminal repeat (3 copies)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...