6P4BC

Hyhel10 fab variant hyhel10-4x (heavy chain mutations l4f, y33h, s56n, and y58f) bound to hen egg lysozyme variant hel2x-flex (mutations r21q, r73e, c76s, and c94s)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
129
structure length
129
Chain Sequence
KVFGRCELAAAMKRHGLDNYQGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSENLSNIPCSALLSSDITASVNSAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Resolution of self-reactivity upon vaccination with a conformationally flexible antigen.
rcsb
molecule keywords HyHEL10 Fab light chain
molecule tags Hydrolase/immune system
source organism Mus musculus
total genus 48
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2019-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00062 Lys C-type lysozyme/alpha-lactalbumin family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...