6P8SC

Structure of p. aeruginosa atcc27853 horma1:horma2:peptide 1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
TTVVSRTFRSSPHRDALQTWDAIVELLTQGKDGTARSELRAVTGVAASLIADQAPKSAPIVATCDGPRTRIYCLFDEDAIDGDDANEEVLGFEPLKGDWGVSLPCPKEQLGWVQSALKKHSSRIIARDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HORMA domain proteins and a Trip13-like ATPase regulate bacterial cGAS-like enzymes to mediate bacteriophage immunity
rcsb
molecule tags Protein binding
source organism Pseudomonas aeruginosa
molecule keywords HORMA domain containing protein
total genus 38
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2019-06-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...