6PERA

Crystal structure of ligand-free iserosnfr
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
518
structure length
506
Chain Sequence
NDTVVVGSINHTEQIIVANMLAEMIEAHTDLKVVRKLNLGGVNVNFEAIKRGGANNGIDIYLEYVGYGLVDILGYPEPNVYIIADKQKNGIKANFKIRYNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITLGSMSKGEELFTGVVPILVELDGGVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFPPPGATDPEGAYETVKKEYKRKWNIVWLKPLGFNASYVLAVKDELAKQYNLKTFSDLAKISDKLILGANMMFLENPDGYPGLQKLYNFKFKHTKSMDAGIPYTAIDNNEVQVIDATATDGLLVSHKLKILEDDKAFFPPYYAAPIIRQDVLDKHPELKDVLNKLANQISLEEMQKLNYKRDGEGQDPAKVAKEFLKEKGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords iSeroSnFR, a soluble, genetically-encoded fluorescent sensor
publication title Machine-learning guided directed evolution of a potent and selective fluorescent sensor for serotonin
rcsb
source organism Thermoanaerobacter sp. x513
total genus 162
structure length 506
sequence length 518
ec nomenclature
pdb deposition date 2019-06-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...