6PFPA

Crystal structure of amino acids 1473-1536 of human beta cardiac myosin fused to gp7 and eb1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
156
structure length
156
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Myosin-7 fused to GP7 and EB1
publication title A Complete Model of the Cardiac Myosin Rod
rcsb
source organism Homo sapiens
total genus 73
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-06-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...