6PGCA

Wdr5delta32 bound to methyl benzyl(4-(4-(hydroxymethyl)-1h-imidazol-2-yl)butyl)carbamate
Total Genus 104

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
305
structure length
305
Chain Sequence
GSKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI17 (288-291)TI2 (64-67)S1 (36-42)TVIII1 (30-33)TI1 (54-57)TI3 (73-76)S5 (79-84)S3 (59-64)S7 (101-106)S4 (68-73)TIV1 (74-77)TI4 (96-99)TIV2 (115-118)S9 (120-126)S11 (143-148)TI5 (106-109)S12 (152-157)S8 (110-115)TI6 (116-119)TI7 (138-141)TIV3 (157-160)S13 (163-168)S15 (185-190)TI8 (148-151)TI11 (190-193)TI9 (158-161)S19 (228-233)S14 (174-179)TIV4 (212-215)S17 (205-211)TI12 (199-202)S16 (194-199)TI14 (223-226)S18 (217-222)TIV8 (257-260)S21 (247-252)TIV5 (233-236)S23 (273-276)TI15 (243-246)TI16 (278-281)S20 (237-242)S26 (304-309)TIV9 (268-271)TIV10 (287-290)S25 (293-298)S10 (132-137)TI10 (180-183)TI13 (200-203)S24 (282-287)TIV7 (242-245)S22 (264-267)S2 (48-53)S6 (90-95)Updating...
connected with : NaN
molecule tags Protein binding/inhibitor
source organism Homo sapiens
publication title Fragment screening for a protein-protein interaction inhibitor to WDR5.
pubmed doi rcsb
molecule keywords WD repeat-containing protein 5
total genus 104
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2019-06-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.