6PGVA

Human josephin-2 in complex with ubiquitin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
152
Chain Sequence
PTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLATGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the activity and regulation of human Josephin-2
doi rcsb
molecule keywords Josephin-2
molecule tags Hydrolase
source organism Homo sapiens
total genus 37
structure length 152
sequence length 175
ec nomenclature ec 3.4.19.12: ubiquitinyl hydrolase 1.
pdb deposition date 2019-06-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...