The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
125
|
structure length |
125
|
Chain Sequence |
SQATDPFRAAVEFTLMPMLITNPHLPDNPIVFANPAFLKLTGYEADEVMGRNSRFLQGHGTDPAHVRAIKSAIAAEKPIDIDIINYKKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELSR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Asymmetric rearrangement triggers the activation of the Brucella homodimeric blue light sensor histidine kinase LOV-HK
rcsb |
| molecule tags |
Transferase
|
| source organism |
Brucella melitensis biotype 1 (strain 16m / atcc 23456 / nctc 10094)
|
| molecule keywords |
Blue-light-activated histidine kinase
|
| total genus |
35
|
| structure length |
125
|
| sequence length |
125
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
2.7.13.3: Histidine kinase. |
| pdb deposition date | 2019-06-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF13426 | PAS_9 | PAS domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
