6PUPA

1.9 a crystal structure of flavodoxin-like domain of schizosaccharomyces japonicus putative trnaphe 4-demethylwyosine synthase tyw1 in complex with fmn
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
TDISACSINIFYSTLGGSTQKFAEHVADRIRSSLQTELVEILNLDYIDLDEYFSKGNSNTVYLVLLPSYAIESSIDYFLSALQTTIDDFRIVARPLEKLRGFAVLGFGDFEQYAGDLFCYQAIAADQRLAKLGAQRIAPLGVVNVKLEKAQVYEAMEAWTDLFLQYAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Wybutosine biosynthesis protein Tyw1
publication title Biochemical and structural characterization of the flavodoxin-like domain of the Schizosaccharomyces japonicus putative tRNAPhe 4-demethylwyosine synthase Tyw1 in complex with FMN.
pubmed doi rcsb
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).
pdb deposition date 2019-07-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...