6Q63A

Bt0459
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
751
structure length
751
Chain Sequence
QEEANYQIIPLPQEIVTSQVNPFILKSGVKILYPEGNEKMQRNAQFLADYLKTATGKDFSIEAGTEGKNAIVLALGSEVENPESYQLKVTDQGVTITAPTEAGVFYGIQTLRKSLPIALGADVALPAVEIKDAPRFGYRGAHFDVSRHFFTIDEVKTYIDMLALHNMNRLHWHITDDQGWRLEIKKYPKLTEIGSQRSGTVIGRNSGEYDNTPYGGFYTQEQAKEIVDYAAERYITVVPEIDLPGHMLAALAAYPELGCTGGPYEVWRQWGVADDVLCAGNDQVLKFLEDVYGELIEIFPSEYIHVGGDECPKVRWEKCPKCQARIKALGLKSDKNHSKEERLQSFVINHIEKFLNDHGRQIIGWDEILEGGLAPNATVMSWRGESGGIEAAKQKHDVIMTPNTYLYFDYYQAKDTENEPFGIGGYLPMERVYSYEPMPASLTPDEQQYIKGVQANLWTEYIATFSHAQYMVLPRWAALCEVQWSTPDKKNYEDFLSRLPRLIKWYDAEGYNYAKHVFDVKAEFTPNPADGTLDITLTTIDNAPIHYTLDGTEPTSTSPVYDGALKIKENADFSAIAIRPTGNSRVVSEKIDFSKSSMKPIVANQPVNKQYEFKGVSTLVDGLKGNGNYKTGRWIAFRGNDMDVTIDLKQPTEISSVAISTCVEKGDWVFDTRGLSVEVSEDGTNFTKVASEAYPAMKETDKNGVYDHKLTFTPVTAQYVKVIASPEKSIPEWHGGKSYPGFLFVDEITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complex N-glycan breakdown by gut Bacteroides involves an extensive enzymatic apparatus encoded by multiple co-regulated genetic loci.
pubmed doi rcsb
molecule keywords Beta-hexosaminidase
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
total genus 241
structure length 751
sequence length 751
chains with identical sequence B, C
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2018-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF00754 F5_F8_type_C F5/8 type C domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
A PF13287 Fn3_assoc Fn3 associated
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...