6Q8XJ

Respiratory complex i from thermus thermophilus with bound pyridaben.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key role of quinone in the mechanism of respiratory complex I.
pubmed doi rcsb
molecule keywords NADH-quinone oxidoreductase subunit 1
molecule tags Membrane protein
total genus 53
structure length 160
sequence length 160
chains with identical sequence R
ec nomenclature ec 7.1.1.-:
pdb deposition date 2018-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...