6QSMA

Mtfp* open conformation: i197c-y200h-y204h mutant for enhanced metal binding
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
216
structure length
215
Chain Sequence
SGVIKPDMKIKLKMEGNVNGYAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISLEEDSFIYEIYLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGYYRVDFKTIYRAKKAVKLPDYHFVDHRIECLNHDKDHNKVTVYESAVARNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords GFP-like fluorescent chromoprotein cFP484
publication title A Robust and Versatile Host Protein for the Design and Evaluation of Artificial Metal Centers
rcsb
source organism Clavularia sp.
total genus 61
structure length 215
sequence length 216
ec nomenclature
pdb deposition date 2019-02-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...