6QXGA

Crystal structure of his-tag human thymidylate synthase (ht-hts) in complex with fdump
Total Genus 93

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTVIII1 (194-197)AH1 (29-43)S5 (207-218)TIV7 (218-221)S1 (45-47)S6 (244-258)S7 (278-281)TI1 (49-52)AH2 (81-93)S2 (55-66)O1 (71-73)AH4 (115-121)TII1 (67-70)TIV1 (74-77)AH3 (98-103)AH6 (160-170)TI2 (107-110)TI3 (123-126)3H1 (110-113)TI5 (171-174)AH5 (135-141)AH8 (262-269)TII2 (127-130)TIV3 (131-134)TII4 (153-156)TI4 (148-151)TIV4 (174-177)S3 (178-180)3H2 (184-189)TIV5 (190-193)S4 (196-204)AH7 (222-241)3H3 (259-261)TIV2 (75-78)TII3 (141-144)TIV6 (203-206)Updating...
connected with : NaN
molecule tags Transferase
source organism Homo sapiens
publication title Structural Comparison ofEnterococcus faecalisand Human Thymidylate Synthase Complexes with the Substrate dUMP and Its Analogue FdUMP Provides Hints about Enzyme Conformational Variabilities.
pubmed doi rcsb
molecule keywords Thymidylate synthase
total genus 93
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2019-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.