6R5HA

Major aspartyl peptidase 1 from c. neoformans
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
350
structure length
350
Chain Sequence
ATGTVSLTDVGLDASYAGQVSIGTPAQDFLVIMDSGSSDLWVAGSTCTENFCKQTYTFDTSTSSSFITSSEAFNITYGSGDADGTLGTDTVSMAGFTVSDQTFGVVTSTSANLISYPLSGLMGLAWKSIASSGATPFWQTLAASGDWDSPEMGVYLKRYRGDNTASQIETDGGQILFGGLNTSLYNGSVNYISIDESEKDYWRIPLEAMVIQGNSVSIASSSGGSNPSCAIDTGTTLIGVPSQTANRIYSQIAGAEALSASSGYEGYYQYPCDTEVTVSLQFGGMSYSISNADMNLGSFTRDTSMCTGAFFAMDMSSRSPVQWIVGASFIKNVYTAFRYNPAAIGFAELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Major aspartyl peptidase 1 from C. neoformans
rcsb
molecule tags Hydrolase
source organism Cryptococcus neoformans var. grubii serotype a (strain h99 / atcc 208821 / cbs 1
molecule keywords Endopeptidase
total genus 93
structure length 350
sequence length 350
ec nomenclature
pdb deposition date 2019-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00026 Asp Eukaryotic aspartyl protease
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...