6REPT

Cryo-em structure of polytomella f-atp synthase, primary rotary state 3, composite map
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
523
structure length
523
Chain Sequence
ADAKALDELRKPKFSSKYLIQHVSQKLIPAVKEWEKSYQPPVIHLGRVLSVGDGIARVYGLKSVQAGELVCFDSGVKGMALNLQADHVGVVVFGNDSVIHQGDLVYRTGQIVNVPIGPGTLGRVTDGLGQPIDGKGPLTNVRSSLVEVKAPGIIARQSVREPLFTGVKAVDALVPIGRGQRELIIGDRQTGKTAVAIDAIIHQKNCNEQVPKAQRVYCVYVAVGQKRSTVAQLVKLFTQTGAMRYTIMVSATASDAAPLQFLAPYSGCAMAEYFRDTGKHGLIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSKELGGGSLTAFPVIETQAGDVSAYIATNVISITDGQIFLETELFYKGIRPALNVGLSVSRVGSAAQFPGMKQVAGTLKLELAQYREVAAFAQFGSDLDAATQYVLERGARLTEMLKQKQFAPIPIERQTVAVYAATKGFLDKVRVQDIVAAEEAVISQVNPAVFKILKANGKITPALDAHLKAELRKVKLPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rotary substates of mitochondrial ATP synthase reveal the basis of flexible F1-Focoupling.
pubmed doi rcsb
molecule keywords ASA-10: Polytomella F-ATP synthase associated subunit 10
molecule tags Proton transport
total genus 124
structure length 523
sequence length 523
chains with identical sequence U, V
ec nomenclature
pdb deposition date 2019-04-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...