6RPZA

Cytokine receptor-like factor 3 c-terminus residues 174-442: native collected with 1.7a wavelength
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
264
structure length
252
Chain Sequence
SRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTANHFEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQTGHSTLVPHEWTTGFEGYSLSSRRNIALRNDAESSGVLYSSAPTYFCGQTLTFRVETVGQPDRRDSIGVCAERQNGYESLQRDQAVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVAKLRVTISSNNREVVFDWLLEQACGPLYFGCSFFYPGWKVLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Cytokine receptor-like factor 3
publication title CRLF3 and the hippo pathway are gatekeepers to the final stage of platelet production
rcsb
source organism Mus musculus
total genus 52
structure length 252
sequence length 264
ec nomenclature
pdb deposition date 2019-05-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...