6RXBB

Crystal structure of tetr-q116a from acinetobacter baumannii aye in complex with minocycline
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
199
Chain Sequence
KLDKGTVIAAALELLNEVGMDSLTTRKLAERLKVQQPALYWHFQNKRALLDALAEAMLAERHTRSLPEENEDWRVFLKENALSFRTALLSYRDGARIHAGTRPFGTAETAIRFLCAEGFPKRAVWALRAVSHYVVGSVLEQQASDADEDVSEQAPSSFLHDLFHELETDGMDAAFNFGLDSLIAGFERLRSSTTDHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TetR-Q116A from Acinetobacter baumannii AYE in complex with minocycline
rcsb
molecule keywords Tetracycline repressor protein class G
molecule tags Transcription
source organism Acinetobacter baumannii (strain aye)
total genus 70
structure length 199
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2019-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00440 TetR_N Bacterial regulatory proteins, tetR family
B PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...