6RXYUE

Cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
125
Chain Sequence
LGTVLNQALRTDDSDLLESCLQTLIIQNTINRMDSSLAGTLLSKLAARMHRRPGRAFGLMRWIQWTLVAHGGALVTQPDLINRLTELSRVLEERSRGLSSLLALKGKLDMLDAQLKYRKALKMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords Periodic tryptophan protein 2-like protein
total genus 43
structure length 125
sequence length 128
chains with identical sequence UI
ec nomenclature
pdb deposition date 2019-06-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...