6S6EA

Crystal structure of the engineered ancestor of haloalkane dehalogenases and renilla luciferase (anchld-rluc i161_f162pinsl)
Total Genus 112

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
TATGDEWWAKCKQVDVLDSEMSYYDSDPGKHKNTVIFLHGNPTSSYLWRNVIPHVEPLARCLAPDLIGMGKSGKLPNHSYRFVDHYRYLSAWFDSVNLPEKVTIVCHDWGSGLGFHWCNEHRDRVKGIVHMESVVSPLKGWESFPETARDILPQALRSEAGEEMVLKKNFFIERLLPSSIMRKLSEEEMDAYREPFVEPGESRRPTLTWPREIPIKGDGPEDVIEIVKSYNKWLSTSKDIPKLFINADPGFFSNAIKKVTKNWPNQKTVTVKGLHFLQEDSPEEIGEAIADFLNELT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (14-20)S1 (21-26)TI2 (85-88)S4 (70-74)3H1 (55-58)3H2 (62-64)TII'1 (26-29)S2 (29-35)AH3 (119-130)AH2 (92-104)TIV1 (35-38)TII1 (37-40)3H3 (66-68)EMPTYAH5 (180-189)TIV2 (50-53)TI1 (58-61)AH6 (196-203)TII2 (76-79)3H7 (219-222)TII'2 (79-82)TIV4 (104-107)TI3 (131-134)TII3 (273-276)TVIII1 (109-112)TIV11 (226-229)AH9 (262-270)AH8 (231-246)S6 (135-141)TIV5 (140-143)TI5 (150-153)3H4 (156-158)AH7 (214-218)TI7 (158-161)TIV6 (161-164)TIV7 (162-165)TI8 (159-162)TIV8 (163-166)3H5 (204-206)3H6 (211-213)TI9 (160-163)TII'3 (164-167)TI10 (165-168)AH4 (170-177)TIV9 (190-193)S8 (276-283)TIV10 (225-228)TI12 (270-273)S7 (252-259)TI11 (247-250)TVIb1 (257-260)3H8 (287-289)TIV12 (283-286)TIV14 (289-292)S3 (44-48)S5 (112-117)AH10 (292-306)Updating...
connected with : NaN
molecule tags Luminescent protein
source organism Synthetic construct
publication title Insertion-Deletion Mutagenesis of a Thermostable Ancestral Enzyme Confers Protein Backbone Motions Being Essential for the Emergence of Enzymatic Function
rcsb
molecule keywords Engineered ancestor of haloalkane dehalogenases and Renilla
total genus 112
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-07-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.