6SCFA

A viral anti-crispr subverts type iii crispr immunity by rapid degradation of cyclic oligoadenylate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
113
structure length
113
Chain Sequence
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
rcsb
molecule keywords Uncharacterized protein
molecule tags Dna
source organism Sulfolobus islandicus rod-shaped virus 1
total genus 29
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2019-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...