6SDUA

Xyloglucanase domain of nopaa, a type three effector from sinorhizobium fredii in complex with cellobiose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
222
Chain Sequence
GMPIWSSHAPYGSFSRDGYSWNNDVWGPRPGPQTISVSGVNRWSVWSDQPNTPGIKSYPHVAFNIGKPLSSINTLSSSFNQEVPTGGAWDVAYDIWDSSNKHEIMLWTNYTGNSDGSGNVKPISYHYAPSGAAIPVYSNVNVGGATWNVFEGEGPDGHKVISLLRTSKTNSGTVDIKSILQWIKSKGYFGDIEVGSVQYGVEITSSPGGKNFNFNNWSVTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Type III effector NopAA
publication title Structural and enzymatic characterisation of the Type III effector NopAA (=GunA) from Sinorhizobium fredii USDA257 reveals a Xyloglucan hydrolase activity.
pubmed doi rcsb
source organism Sinorhizobium fredii usda 257
total genus 63
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-07-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...