6SMDA

Plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
77
Chain Sequence
NHPEVKIKTILSLFLNINIDDFNMDANLADAYDMDTELADLAKEIEKEFGISVTKSQFSHWETGRAVLDFVSSSLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the minimal PKS system responsible for octaketide biosynthesis.
pubmed doi rcsb
molecule tags Protein binding
source organism Photorhabdus luminescens
molecule keywords Acyl carrier protein
total genus 22
structure length 77
sequence length 78
ec nomenclature
pdb deposition date 2019-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...